PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g096610.1
Common NameMTR_5g096610
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 123aa    MW: 14174 Da    PI: 6.2552
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g096610.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.72.3e-1271112244
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      g+WT eEd ll  +  ++G + Wk+Iar++  +R++ qc+sr+
  Medtr5g096610.1  71 GAWTREEDNLLFLGLVLYGHK-WKRIARELVITRSASQCRSRF 112
                      79*******************.*********99*********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.3559IPR001005SANT/Myb domain
SuperFamilySSF466892.99E-5657IPR009057Homeodomain-like
PROSITE profilePS500903.95757IPR017877Myb-like domain
PROSITE profilePS5129412.11665120IPR017930Myb domain
SuperFamilySSF466891.0E-1068112IPR009057Homeodomain-like
SMARTSM007171.5E-969118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-1171112IPR009057Homeodomain-like
PfamPF002498.5E-1271112IPR001005SANT/Myb domain
CDDcd001671.93E-972112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 123 aa     Download sequence    Send to blast
MAGQGGGNWT GEDTLRLREA MQQFPPHTNN RYLMILQAFP EERRQDIAIL EHYLEELAGE  60
EQQFLPPQNF GAWTREEDNL LFLGLVLYGH KWKRIARELV ITRSASQCRS RFGTQAFAGF  120
NF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT9631071e-129CT963107.2 Medicago truncatula chromosome 5 clone mte1-34b22, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003617890.17e-87myb transcription factor
TrEMBLG7K4S98e-87G7K4S9_MEDTR; Myb transcription factor
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.24e-07myb domain protein 3r-5
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]